Amplification and function analysis of N6-adenine-specific DNA methyltransferase gene in Nilaparvata lugens
Methylation of the N6 position of adenine, termed N6-methyladenine, protects DNA from restriction endonucleases via the host-specific restriction-modification system. N6-methyladenine was discovered and has been well studied in bacteria. N6-adenine-specific DNA methyltransferase (N6AMT) is the main...
Saved in:
| Main Authors: | , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
KeAi Communications Co., Ltd.
2016-03-01
|
| Series: | Journal of Integrative Agriculture |
| Subjects: | |
| Online Access: | http://www.sciencedirect.com/science/article/pii/S2095311916616404 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1839642999887233024 |
|---|---|
| author | Jiao ZHANG Yan-ru XING Bo-feng HOU Zhu-ting YUAN Yao LI Wen-cai JIE Yang SUN Fei LI |
| author_facet | Jiao ZHANG Yan-ru XING Bo-feng HOU Zhu-ting YUAN Yao LI Wen-cai JIE Yang SUN Fei LI |
| author_sort | Jiao ZHANG |
| collection | DOAJ |
| description | Methylation of the N6 position of adenine, termed N6-methyladenine, protects DNA from restriction endonucleases via the host-specific restriction-modification system. N6-methyladenine was discovered and has been well studied in bacteria. N6-adenine-specific DNA methyltransferase (N6AMT) is the main enzyme catalyzing the methylation of the adenine base and knowledge of this enzyme was mainly derived from work in prokaryotic models. However, large-scale gene discovery at the genome level in many model organisms indicated that the N6AMT gene also exists in eukaryotes, such as humans, mice, fruit flies and plants. Here, we cloned a N6AMT gene from Nilaparvata lugens (Nlu-N6AMT) and amplified its full-length transcript. Then, we carried out a systematic investigation of N6AMT in 33 publically available insect genomes, indicating that all studied insects had N6AMT. Genomic structure analysis showed that insect N6AMT has short introns compared with the mammalian homologs. Domain and phylogenetic analysis indicated that insect N6AMT had a conserved N6-adenineMlase domain that is specific to catalyze the adenine methylation. Nlu-N6AMT was highly expressed in the adult female. We knocked down Nlu-N6AMT by feeding dsRNA from the second instar nymph to adult female, inducing retard development of adult female. In all, we provide the first genome-wide analysis of N6AMT in insects and presented the experimental evidence that N6AMT might have important functions in reproductive development and ovary maturation. |
| format | Article |
| id | doaj-art-2a2a34a73a0649d2a6ec6b1ae44e1de4 |
| institution | Matheson Library |
| issn | 2095-3119 |
| language | English |
| publishDate | 2016-03-01 |
| publisher | KeAi Communications Co., Ltd. |
| record_format | Article |
| series | Journal of Integrative Agriculture |
| spelling | doaj-art-2a2a34a73a0649d2a6ec6b1ae44e1de42025-07-02T04:51:25ZengKeAi Communications Co., Ltd.Journal of Integrative Agriculture2095-31192016-03-01153591599Amplification and function analysis of N6-adenine-specific DNA methyltransferase gene in Nilaparvata lugensJiao ZHANG0Yan-ru XING1Bo-feng HOU2Zhu-ting YUAN3Yao LI4Wen-cai JIE5Yang SUN6Fei LI7Department of Entomology, College of Plant Protection, Nanjing Agricultural University/Key Laboratory of Monitoring and Management of Plant Diseases and Insects, Ministry of Agriculture, Nanjing 210095, P.R. China; ZHANG Jiao, Tel: +86-25-84399920Department of Entomology, College of Plant Protection, Nanjing Agricultural University/Key Laboratory of Monitoring and Management of Plant Diseases and Insects, Ministry of Agriculture, Nanjing 210095, P.R. ChinaDepartment of Entomology, College of Plant Protection, Nanjing Agricultural University/Key Laboratory of Monitoring and Management of Plant Diseases and Insects, Ministry of Agriculture, Nanjing 210095, P.R. ChinaDepartment of Entomology, College of Plant Protection, Nanjing Agricultural University/Key Laboratory of Monitoring and Management of Plant Diseases and Insects, Ministry of Agriculture, Nanjing 210095, P.R. ChinaDepartment of Entomology, College of Plant Protection, Nanjing Agricultural University/Key Laboratory of Monitoring and Management of Plant Diseases and Insects, Ministry of Agriculture, Nanjing 210095, P.R. ChinaDepartment of Entomology, College of Plant Protection, Nanjing Agricultural University/Key Laboratory of Monitoring and Management of Plant Diseases and Insects, Ministry of Agriculture, Nanjing 210095, P.R. ChinaDepartment of Entomology, College of Plant Protection, Nanjing Agricultural University/Key Laboratory of Monitoring and Management of Plant Diseases and Insects, Ministry of Agriculture, Nanjing 210095, P.R. ChinaDepartment of Entomology, College of Plant Protection, Nanjing Agricultural University/Key Laboratory of Monitoring and Management of Plant Diseases and Insects, Ministry of Agriculture, Nanjing 210095, P.R. China; Key Lab of Agricultural Entomology, Ministry of Agriculture/Institute of Insect Sciences, Zhejiang University, Hangzhou 310058, P.R. China; Correspondence LI Fei, Tel: +86-571-88982679Methylation of the N6 position of adenine, termed N6-methyladenine, protects DNA from restriction endonucleases via the host-specific restriction-modification system. N6-methyladenine was discovered and has been well studied in bacteria. N6-adenine-specific DNA methyltransferase (N6AMT) is the main enzyme catalyzing the methylation of the adenine base and knowledge of this enzyme was mainly derived from work in prokaryotic models. However, large-scale gene discovery at the genome level in many model organisms indicated that the N6AMT gene also exists in eukaryotes, such as humans, mice, fruit flies and plants. Here, we cloned a N6AMT gene from Nilaparvata lugens (Nlu-N6AMT) and amplified its full-length transcript. Then, we carried out a systematic investigation of N6AMT in 33 publically available insect genomes, indicating that all studied insects had N6AMT. Genomic structure analysis showed that insect N6AMT has short introns compared with the mammalian homologs. Domain and phylogenetic analysis indicated that insect N6AMT had a conserved N6-adenineMlase domain that is specific to catalyze the adenine methylation. Nlu-N6AMT was highly expressed in the adult female. We knocked down Nlu-N6AMT by feeding dsRNA from the second instar nymph to adult female, inducing retard development of adult female. In all, we provide the first genome-wide analysis of N6AMT in insects and presented the experimental evidence that N6AMT might have important functions in reproductive development and ovary maturation.http://www.sciencedirect.com/science/article/pii/S2095311916616404N6-adenine-specific DNA methyltransferase (N6AMT)Nilaparvata lugens, expressionRNA interferencegene structure |
| spellingShingle | Jiao ZHANG Yan-ru XING Bo-feng HOU Zhu-ting YUAN Yao LI Wen-cai JIE Yang SUN Fei LI Amplification and function analysis of N6-adenine-specific DNA methyltransferase gene in Nilaparvata lugens Journal of Integrative Agriculture N6-adenine-specific DNA methyltransferase (N6AMT) Nilaparvata lugens, expression RNA interference gene structure |
| title | Amplification and function analysis of N6-adenine-specific DNA methyltransferase gene in Nilaparvata lugens |
| title_full | Amplification and function analysis of N6-adenine-specific DNA methyltransferase gene in Nilaparvata lugens |
| title_fullStr | Amplification and function analysis of N6-adenine-specific DNA methyltransferase gene in Nilaparvata lugens |
| title_full_unstemmed | Amplification and function analysis of N6-adenine-specific DNA methyltransferase gene in Nilaparvata lugens |
| title_short | Amplification and function analysis of N6-adenine-specific DNA methyltransferase gene in Nilaparvata lugens |
| title_sort | amplification and function analysis of n6 adenine specific dna methyltransferase gene in nilaparvata lugens |
| topic | N6-adenine-specific DNA methyltransferase (N6AMT) Nilaparvata lugens, expression RNA interference gene structure |
| url | http://www.sciencedirect.com/science/article/pii/S2095311916616404 |
| work_keys_str_mv | AT jiaozhang amplificationandfunctionanalysisofn6adeninespecificdnamethyltransferasegeneinnilaparvatalugens AT yanruxing amplificationandfunctionanalysisofn6adeninespecificdnamethyltransferasegeneinnilaparvatalugens AT bofenghou amplificationandfunctionanalysisofn6adeninespecificdnamethyltransferasegeneinnilaparvatalugens AT zhutingyuan amplificationandfunctionanalysisofn6adeninespecificdnamethyltransferasegeneinnilaparvatalugens AT yaoli amplificationandfunctionanalysisofn6adeninespecificdnamethyltransferasegeneinnilaparvatalugens AT wencaijie amplificationandfunctionanalysisofn6adeninespecificdnamethyltransferasegeneinnilaparvatalugens AT yangsun amplificationandfunctionanalysisofn6adeninespecificdnamethyltransferasegeneinnilaparvatalugens AT feili amplificationandfunctionanalysisofn6adeninespecificdnamethyltransferasegeneinnilaparvatalugens |